Please use this identifier to cite or link to this item: https://www.arca.fiocruz.br/handle/icict/7069
Title: Identificação e validação de antagonistas potenciais de APRIL através da aplicação de cálculos de energia livre e dinâmica molecular
Advisor: Caffarena, Ernesto Raúl
Savino, Wilson
Authors: Silva, João Hermínio Martins da
Affilliation: Fundação Oswaldo Cruz. Instituto Oswaldo Cruz. Rio de Janeiro, RJ, Brasil.
Abstract: O ligante APRIL (do inglês: A Proliferating Inducing Ligand) foi descrito pela primeira vez por Hahne et al, em 1998, e inicialmente caracterizado pela sua capacidade de estimular a proliferação de células tumorais in vitro. Atualmente, três receptores para APRIL são conhecidos: B-Cell Maturation Antigen (BCMA), Transmembrane Activator and CAML Interactor (TACI), os quais são expressos principalmente por linfócitos B, e Heparan Sulphate Proteoglycan (HSPG). BCMA e TACI também são capazes de se ligar ao ligante B-Cell Activation Factor (BAFF), outra proteína da família TNF que compartilha uma alta similaridade estrutural com APRIL. Recentes descrições de camundongos deficientes em APRIL mostraram que essa proteína não é essencial para a manutenção da homeostase do sistema imune saudável, estando associada somente à proliferação de células tumorais, enquanto BAFF é um fator de sobrevivência fundamental para a maturação de linfócitos B. Dessa maneira, como BAFF é um fator crucial para o funcionamento do sistema imune, bloquear a interação de BAFF irá afetar a homeostase imunológica, comprometendo a imunidade do indivíduo. O objetivo desse trabalho é gerar uma série de peptídeos antagonistas de APRIL, combinando ferramentas computacionais e experimentais. Através da combinação de “Alanine Scanning” computacional com cálculo de energia livre utilizando “Linear Interaction Energy” (LIE) nos complexos APRIL-TACI e BAFF-TACI, foi possível determinar a importância de cada resíduo na estrutura de TACI, apontando a contribuição energética individual para a especificidade da ligação APRIL-TACI. Os coeficientes padrão de LIE foram utilizados. A partir dos resultados de LIE, foram desenhados seis peptídeos mutados, tendo TACI como modelo, com potencial atividade inibitória para APRIL, sem interferir com a estrutura de BAFF:T8: CRKELLKFYDHLLEDCISCANICGQHPRQCAYFC T9: CRKEQFKFYDHLLDDCISCAQICGQHPHQCAYFC T10:CRKEQFKFYDHLLDDCISCAQTCGQHPHQCAYFC T11:CRKEQFKFYDELLDDCISCAQICGQHPHQCAYFC xv T12:CRKELFKFYDHLEDDCISCAQTCGQHPHQCAYFC T13:CRKELFKFYDHLEDDCISCAQSCYQHQHQCAYFC A estabilidade dos peptídeos foi analisada por dinâmica molecular em complexo com os dois ligantes, APRIL e BAFF, através da avaliação da estrutura secundária ao longo de 30 nanosegundos, quantificação das ligações hidrogênio e pontes salinas, e medição da superfície acessível ao solvente. Após a dinâmica molecular, os melhores candidatos foram escolhidos em função do aumento do número de pontes de hidrogênio e pontes salinas formadas com APRIL. Os peptídeos T12 e T13 foram excluídos devido à perda da estrutura secundária inicial. Os quatro melhores candidatos, do ponto de vista computacional, foram clonados em bactérias e os plasmídeos foram transfectados em células eucarióticas 293T. Seguiu-se então a purificação do sobrenadante produzido pelas células transfectadas. O sucesso da transfecção foi confirmado por imunoblotting. A atividade inibitória desses peptídeos foi testada por ELISA após a purificação. Dentre os quatro peptídeos, dois foram capazes de reduzir sensivelmente a densidade ótica, indicando que houve efeito inibidor para esses peptídeos. Os resultados apontam que a estratégia elaborada nesse trabalho pode ser aplicada ao desenho de sequências peptídicas direcionadas à inibição de um alvo proteico específico.
Abstract: The APRIL ligand (A Proliferating Inducing Ligand) was first described by Hahne et al, in 1998 and, initially, was characterized by its capacity of stimulate the proliferation of tumor cells in vitro. Currently, three APRIL receptors are known: B-Cell Maturation Antigen (BCMA), Transmembrane Activator and CAML Interactor (TACI), which are expressed mainly by B cells, and Heparan Sulphate Proteoglycan (HSPG). BCMA and TACI are also capable of bind to the ligand B-Cell Activation Factor (BAFF), another TNF family protein, sharing a high structural similarity with APRIL. Recent descriptions of knock-out mice for APRIL showed that this protein is not essential for the homeostasis of health immune system, while BAFF is a fundamental survival factor, directly related to the maturation of B cells. Thus, as BAFF is a crucial factor for the physiology of B cells, blocking the interaction of BAFF with TACI or BCMA could interfere with the immune homeostasis, compromising the individual immunity. The objective of this work is to generate a set of APRIL antagonist peptides, combining computational and experimental approaches. Through the combination of computational “Alanine Scanning” with free energy calculations employing “Linear Interaction Energy” (LIE) in the APRIL-TACI and BAFF-TACI complexes, we determined the importance of each residue in TACI structure, pointing the individual energetic contribution for the specificity of the APRIL-TACI binding. Taking these results as a start point, we proposed six mutated peptides, based on TACI structure, specifically designed to the blockage of APRIL, without interfering with BAFF activity. T8: CRKELLKFYDHLLEDCISCANICGQHPRQCAYFC T9: CRKEQFKFYDHLLDDCISCAQICGQHPHQCAYFC T10:CRKEQFKFYDHLLDDCISCAQTCGQHPHQCAYFC T11:CRKEQFKFYDELLDDCISCAQICGQHPHQCAYFC T12:CRKELFKFYDHLEDDCISCAQTCGQHPHQCAYFC T13:CRKELFKFYDHLEDDCISCAQSCYQHQHQCAYFC xvii The stability of these peptides was analyzed using molecular dynamics in complex with APRIL and BAFF ligands, by the evaluation of the secondary structure along the 30 nanoseconds of simulations, as well as quantification of hydrogen bonds and salt bridges, and measurement of the solvent accessible surface. After the molecular dynamics, the four best candidates were selected, by the computational point of view. The T12 and T13 peptides were excluded due to the loss of secondary structure. These candidates were cloned in bacteria and the plasmids were transfected in 293T eukaryotic cells. The cells supernatant was purified and the transfection was tested by ELISA. Among the four peptides, two were able to inhibit selectively the APRIL expression, according to the decrease of optical density. The results indicate that the elaborated strategy can be applied to the design of peptide sequences directed to the inhibition of a specific protein target.
Keywords: Membro 13 da Superfamília de Ligantes de Fatores de Necrose Tumoral
B-Cell Maturation Antigen
Transmembrane Activator and CAML Interactor Protein
Issue Date: 2011
Citation: SILVA, João Hermínio Martins da. Identificação e validação de antagonistas potenciais de APRIL através da aplicação de cálculos de energia livre e dinâmica molecular. Rio de Janeiro, 2011. 172 f. Tese (Doutorado em Biologia Celular e Molecular)-Fundação Oswaldo Cruz, Instituto Oswaldo Cruz. Rio de Janeiro, 2011.
Date of defense: 2011
Place of defense: Rio de Janeiro/ RJ
Department: Pós-Graduação em Biologia Celular e Molecular
Defense institution: Fundação Oswaldo Cruz. Instituto Oswaldo Cruz
Program: Programa de Pós-Graduação em Biologia Celular e Molecular
Copyright: open access
Appears in Collections:IOC - PGBCM - Teses de Doutorado

Files in This Item:
File Description SizeFormat 
joao_silva_ioc_dout_2011.pdf6.08 MBAdobe PDFThumbnail
View/Open



FacebookTwitterDeliciousLinkedInGoogle BookmarksBibTex Format mendeley Endnote DiggMySpace

Items in DSpace are protected by copyright, with all rights reserved, unless otherwise indicated.